PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013370m
Common NameCARUB_v10013370mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 559aa    MW: 63110.6 Da    PI: 4.2572
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013370mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.4e-5191361128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +++yk+ePwdLp  +k+k+++ ewyfFs+ d+ky +g+++nrat+ gyWk+tgkd+e+
  Carubv10013370m   9 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVAHVYKSEPWDLPdkAKLKSRDLEWYFFSTLDSKYGNGSKTNRATEMGYWKTTGKDREI 101
                      579**************************9.99**************95337777777************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Carubv10013370m 102 RN-GSKVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                      *9.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-607159IPR003441NAC domain
PROSITE profilePS5100557.2989159IPR003441NAC domain
PfamPF023659.1E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MGGGSATSLA PGFRFHPTDE ELVRYYLKRK ICNKPFKFDA ISVAHVYKSE PWDLPDKAKL  60
KSRDLEWYFF STLDSKYGNG SKTNRATEMG YWKTTGKDRE IRNGSKVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLVDEE LEKTGVHQDA YVLCRIFQKS GSGPKNGEQY GAPFVEEEWE  180
EEDDMSFEPD PDLGSEDHVY VHMDDTDQKP DNLVVYDAIP LPLNFNHGES SNNAETNYSD  240
SINYIQPGNY VDSGGYFEKP EECSEKDQKP IICDGNLHNE ALFQDDEIGS GVQNEQMANL  300
QSSDNMFGTG SLCYNDLSVE SNYLIGDAFL DPNSNLLHND GLYLETNDLS STQQDGFYFE  360
DYLTFFDEDD ENAQNLTFDP SQLMGNEDAF VDQEELFQEI ETEELKKEET IGDKQVVEEK  420
EKDEASCSKQ FDADATEFEP DYKYPFLKKA SDMLGAIPAP PAFASEFPTK DAAIRLNAGQ  480
SSGSVHVTAG MITISDSNMG WSYDKNVNRD LILSYHFVQE NASGKLGNSL TRAMLIFMCF  540
WILLLSVSFK VSTLVASR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-45816516171NO APICAL MERISTEM PROTEIN
1ut4_B5e-45816516171NO APICAL MERISTEM PROTEIN
1ut7_A5e-45816516171NO APICAL MERISTEM PROTEIN
1ut7_B5e-45816516171NO APICAL MERISTEM PROTEIN
3swm_A5e-45816519174NAC domain-containing protein 19
3swm_B5e-45816519174NAC domain-containing protein 19
3swm_C5e-45816519174NAC domain-containing protein 19
3swm_D5e-45816519174NAC domain-containing protein 19
3swp_A5e-45816519174NAC domain-containing protein 19
3swp_B5e-45816519174NAC domain-containing protein 19
3swp_C5e-45816519174NAC domain-containing protein 19
3swp_D5e-45816519174NAC domain-containing protein 19
4dul_A5e-45816516171NAC domain-containing protein 19
4dul_B5e-45816516171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0510030.0AY051003.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
GenBankAY0793450.0AY079345.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297351.10.0hypothetical protein CARUB_v10013370mg
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLR0HKM10.0R0HKM1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__1085__AT3G10500.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.10.0NAC domain containing protein 53